PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019957.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family CO-like
Protein Properties Length: 341aa    MW: 37977.5 Da    PI: 6.1839
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019957.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.74.7e-08436436
     zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                 + C+ +++   +lfC+ ++ +lC +C +++H  
  Pbr019957.1  4 KLCDSCKSATGTLFCRADSAFLCVNCDSKIHAA 36
                 68*****************************54 PP

2zf-B_box27.95e-094691342
     zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                  + C+ +e+ +++  C+ ++  lC +C   +H+       H++vp+
  Pbr019957.1 46 VWLCEVCEQAPAHVTCKADDAALCVTCDRDIHSAnplsrrHERVPV 91
                 679*****************************66899999999986 PP

3CCT69.96.5e-24279322144
          CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                  Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Pbr019957.1 279 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 322
                  9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.7E-14148IPR000315B-box-type zinc finger
PROSITE profilePS5011910.381148IPR000315B-box-type zinc finger
PfamPF006431.3E-5443IPR000315B-box-type zinc finger
CDDcd000211.86E-8548No hitNo description
PROSITE profilePS5011910.8364491IPR000315B-box-type zinc finger
PfamPF006432.7E-74691IPR000315B-box-type zinc finger
CDDcd000214.28E-94791No hitNo description
SMARTSM003364.0E-114991IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787279321IPR010402CCT domain
PfamPF062035.0E-18279321IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MALKLCDSCK SATGTLFCRA DSAFLCVNCD SKIHAANKLA SRHARVWLCE VCEQAPAHVT  60
CKADDAALCV TCDRDIHSAN PLSRRHERVP VTPFYDSVNS ATDSVPAVKS AVNFLDDRYF  120
SDVDGEIEAR REEAEAASWL LPNPKAMENP DLNSGQYLFP EMDPYLDLDY GHVDPKLEDA  180
QEQNSCVTDG VVPEQSKNMQ PQLVNDHSFE IDFSAASKPF VYGYHHAQCL GQSVSSSSMD  240
VSIVPDANAM TDVSNPYNKS MTSAVESSHP AVQLSSADRE ARVLRYREKR KNRKFEKTIR  300
YASRKAYAET RPRIKGRFAK RTEVEIEAER TCRYGIVPSF *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0525840.0AF052584.1 Malus domestica cultivar Fuji CONSTANS-like protein 1 (Col1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363242.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-142COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLB3GCI60.0B3GCI6_MALDO; CONSTANS-like 1
STRINGPOPTR_0006s28350.11e-152(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-140CONSTANS-like 4